A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10419 |
Swiss-prot Accession number | P09472 (Sequence in FASTA format) |
Description | Gastrin-releasing peptide (GRP). |
Source organism | Scyliorhinus canicula (Spotted dogfish) (Spotted catshark) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Scyliorhinidae; Scyliorhinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the bombesin/neuromedin-B/ranatensin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRP stimulates gastrin release as well as other gastrointestinal hormones |
Protein Length | 25 Amino acids |
Molecular weight | 2781 |
References | 1 PubMed abstract 3436516 |
Domain Name | N/A |
Hormone Name | Gastrin-releasing peptide |
Mature Hormone Sequence | APVENQGSFPKMFPRGSHWAVGHLM |
Position of mature hormone in Pre-Hormone protein | 25 Residues from position (1-25) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11124 |
Swiss-prot Accession number | P09687 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glucagon-29; Glucagon-33; Glucagon-likepeptide] (Fragments). |
Source organism | Scyliorhinus canicula (Spotted dogfish) (Spotted catshark) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Scyliorhinidae; Scyliorhinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 62 Amino acids |
Molecular weight | 7270 |
References | 1 PubMed abstract 8015974 2 PubMed abstract 3569517 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-33 |
Mature Hormone Sequence | HSEGTFTSDYSKYMDNRRAKDFVQWLMSTKRNG |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11125 |
Swiss-prot Accession number | P09687 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glucagon-29; Glucagon-33; Glucagon-likepeptide] (Fragments). |
Source organism | Scyliorhinus canicula (Spotted dogfish) (Spotted catshark) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Scyliorhinidae; Scyliorhinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 62 Amino acids |
Molecular weight | 7270 |
References | 1 PubMed abstract 8015974 2 PubMed abstract 3569517 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-29 |
Mature Hormone Sequence | HSEGTFTSDYSKYMDNRRAKDFVQWLMST |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11126 |
Swiss-prot Accession number | P09687 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glucagon-29; Glucagon-33; Glucagon-likepeptide] (Fragments). |
Source organism | Scyliorhinus canicula (Spotted dogfish) (Spotted catshark) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Scyliorhinidae; Scyliorhinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 62 Amino acids |
Molecular weight | 7270 |
References | 1 PubMed abstract 8015974 2 PubMed abstract 3569517 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide |
Mature Hormone Sequence | HAEGTYTSDVDSLSDYFKAKRFVDSLK |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (34-62) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |